PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011097601.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 331aa    MW: 37110.6 Da    PI: 5.0399
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011097601.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.35.7e-25958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k+ien++nrqvtfskRr g++KKA+E+ vLCd++ a+i+fs++g+l  +s
  XP_011097601.1  9 KKIENTTNRQVTFSKRRYGLIKKAYEIAVLCDIDLALIMFSPSGRLSHFS 58
                    68********************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.16161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-28290IPR002100Transcription factor, MADS-box
CDDcd002651.92E-32278No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-23323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRSKLPIKK IENTTNRQVT FSKRRYGLIK KAYEIAVLCD IDLALIMFSP SGRLSHFSGR  60
KRVEDVIYRY INLSDRDRGG IIPNREQIIN TLMKIKTEKD LAIQSPATPG SDIEEIQKQI  120
LDLQHQLERD EDQLRVFEPN SEKFTSLDEF QSCEVRLTEA LRRVTQRKRI LLSKVEQQSS  180
YQDTIQQINT VVQYITEAQV LAAAQPSLEN EEDHGIEIGT GDNMNIGSDA SSVSIRERSS  240
PTVFESVSQT SGNENAQSAE GYQSSNIKDD GFQQYLSSKD LFSALLPPES STSLAKGVME  300
SSIGGALTTL DQQTLVLESH CHQLPSSELH L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-16175174Myocyte-specific enhancer factor 2B
1tqe_Q4e-16175174Myocyte-specific enhancer factor 2B
1tqe_R4e-16175174Myocyte-specific enhancer factor 2B
1tqe_S4e-16175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097601.10.0PREDICTED: agamous-like MADS-box protein AGL8
SwissprotQ1PFC25e-61AGL66_ARATH; Agamous-like MADS-box protein AGL66
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130701416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.13e-62AGAMOUS-like 66